Analytical Data
-
Gene name
Siglec-3/CD33
-
简介
Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, hFc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
1.Immobilized Human Siglec-3 at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Biotinylated Anti-Siglec-3 Antibody, hFc Tag with the EC50 of 21.8 ng/mL determined by ELISA. 2.Immobilized Human CD33 at 2 μg/mL (100 μL/well) can bind Anti-CD33 Antibody, the ED50 for this effect is 8.312 ng/mL. Immobilized Human CD33 at 2 μg/mL (100 μL/well) can bind Anti-CD33 Antibody, The ED50 for this effect is 8.312 ng/mL.
-
Alternative Names
Myeloid Cell Surface Antigen CD33; Siglec-3; gp67; CD33; SIGLEC3
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20138-1
-
Expression Region
D18-H259
-
AA Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
-
Protein Length
Extracellular Domain
-
Molecular Weight
68-80 kDa (glycosylation)
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Siglec-3, also known as CD33, is a sialic acid-binding immunoglobulin-like lectin predominantly expressed on the surface of myeloid cells, including monocytes and granulocytes. Its role in the immune system is significant, as it is involved in regulating cellular interactions and modulating immune responses. CD33 functions primarily as an inhibitory receptor, playing a crucial role in the negative regulation of immune activation. Elevated expression of CD33 has been associated with various hematological malignancies, particularly in acute myeloid leukemia (AML), where it serves as a potential therapeutic target. Research into recombinant CD33 proteins has gained momentum due to their potential utility in targeted therapies and drug delivery systems. By engineering CD33-based recombinant proteins, scientists aim to explore their ability to selectively bind to CD33-expressing cells, allowing for the development of novel immunotherapeutic approaches that can enhance the efficacy of existing treatments while minimizing side effects. Additionally, these studies aim to unravel the mechanistic insights behind CD33's role in immune modulation, and its involvement in tumor microenvironments. Overall, the investigation of Siglec-3/CD33 recombinant proteins holds promise in improving therapeutic strategies for cancer and other diseases linked to immune dysfunction, paving the way for innovative treatments that could lead to more effective patient outcomes.











