Analytical Data
-
Gene name
ROR1
-
简介
ROR1 protein is an important member of the Tyr protein kinase family in the protein kinase superfamily and plays a key role as a tyrosine kinase in cell signaling and regulation. Its classification emphasizes its importance in phosphorylation events and shares conserved features with related kinases. ROR1 Protein, Rat (HEK293, His) is the recombinant rat-derived ROR1 protein, expressed by HEK293 , with C-10*His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED50 of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg. Measured by its binding ability in a functional ROR1. Immobilized ROR1 at 2 μg/ml can bind Anti-ROR1 antibody, the ED50 of Rat ROR1 protein is 0.168 μg/mL, corresponding to a specific activity is 5.95×103 units/mg.
-
Alternative Names
ROR1; NTRKR1
-
Species
Rat
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
D3ZZ97
-
Expression Region
Q30-E403
-
AA Sequence
QETELSVSAELVPTSSWNTSSEIDKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
-
Protein Length
Partial
-
Molecular Weight
60-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ROR1 (Receptor tyrosine kinase-like orphan receptor 1) is a protein predominantly expressed during embryonic development and is associated with various malignancies, including several types of cancer such as breast cancer, leukemia, and non-small cell lung cancer. Its expression in adult tissues is minimal, making it an attractive target for cancer immunotherapy. Recognized for its role in signaling pathways that control cell survival, proliferation, and differentiation, ROR1's re-emergence in cancer cells suggests a potential for tumor progression. Research into ROR1 has focused on the development of ROR1-targeted therapies, including monoclonal antibodies and CAR T-cell therapy, which aim to selectively eradicate cancer cells while sparing normal cells. The study of recombinant ROR1 proteins is pivotal in understanding its structure-function relationship and interactions with downstream signaling pathways. Such investigations not only elucidate the biological functions of ROR1 but also pave the way for novel therapeutic strategies, ultimately enhancing the efficacy and specificity of cancer treatments.
