Analytical Data
-
Gene name
ROR1
-
简介
ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Application
-
Alternative Names
Inactive tyrosine-protein kinase transmembrane receptor ROR1; Neurotrophictyrosine kinase, receptor-related 1; NTRKR1
-
Species
Human
-
Source
HEK293
-
Tag
C-Avi;C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01973-1
-
Expression Region
Q30-E403
-
AA Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
-
Protein Length
Extracellular Domain
-
Molecular Weight
55-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ROR1 (Receptor tyrosine kinase-like orphan receptor 1) is a protein predominantly expressed during embryonic development and is associated with various malignancies, including several types of cancer such as breast cancer, leukemia, and non-small cell lung cancer. Its expression in adult tissues is minimal, making it an attractive target for cancer immunotherapy. Recognized for its role in signaling pathways that control cell survival, proliferation, and differentiation, ROR1's re-emergence in cancer cells suggests a potential for tumor progression. Research into ROR1 has focused on the development of ROR1-targeted therapies, including monoclonal antibodies and CAR T-cell therapy, which aim to selectively eradicate cancer cells while sparing normal cells. The study of recombinant ROR1 proteins is pivotal in understanding its structure-function relationship and interactions with downstream signaling pathways. Such investigations not only elucidate the biological functions of ROR1 but also pave the way for novel therapeutic strategies, ultimately enhancing the efficacy and specificity of cancer treatments.











