Analytical Data
-
Gene name
CA125
-
简介
The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
- Application
-
Alternative Names
CA125 ovarian cancer antigen; CA-125; FLJ14303; MUC16
-
Species
Human
-
Source
HEK293
-
Tag
C-Avi;C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXI7
-
Expression Region
G12660-M12923
-
AA Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
-
Protein Length
Partial
-
Molecular Weight
80-120 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA125, also known as MUC16, is a mucin glycoprotein primarily expressed on the surface of ovarian carcinoma cells and is widely recognized as a tumor marker for ovarian cancer. The elevation of CA125 levels in the serum is often associated with the presence of ovarian tumors, making it a valuable tool for diagnosis, monitoring treatment response, and assessing prognosis. However, CA125 is not exclusively specific to ovarian cancer, as it can also be elevated in various benign conditions, which limits its utility as a standalone diagnostic marker. The development of recombinant CA125 protein has garnered attention in research for its potential applications in improving diagnostic accuracy and developing therapeutic strategies. Researchers have focused on producing recombinant CA125 to better understand its structure and functions, and to develop more precise diagnostic tests and immunotherapies. Furthermore, investigations into the glycosylation patterns of CA125 may provide insights into its biological behavior and the tumor microenvironment. By utilizing recombinant technology, scientists aim to overcome the limitations associated with traditional serological assays and explore novel avenues for early detection and targeted treatment of ovarian cancer. This ongoing research holds promise for enhancing the clinical management of ovarian cancer patients and improving outcomes through more effective use of CA125 as a biomarker.











