Analytical Data
-
Gene name
L-selectin/CD62L
-
简介
L-selectin/CD62L is a calcium-dependent lectin that binds adjacent glycoproteins to allow lymphocyte adhesion to endothelial cells in peripheral lymph nodes. This encourages leukocytes to bind and roll within endothelial tissue. L-Selectin/CD62L Protein, Rat (HEK293, His) is the recombinant rat-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
L-selectin; LAM-1; LECAM1; TQ1; gp90-MEL; CD62L; SELL; LNHR; LYAM1
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30836
-
Expression Region
W39-N332
-
AA Sequence
WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYN
-
Protein Length
Extracellular Domain
-
Molecular Weight
43-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
L-selectin, also known as CD62L, is a cell adhesion molecule primarily expressed on leukocytes, playing a critical role in the recruitment and homing of immune cells to sites of inflammation and lymphoid organs. Its function is mediated through interactions with specific carbohydrates expressed on endothelial cells and other cells, facilitating the rolling and adhesion of leukocytes during the inflammatory response. The study of L-selectin/CD62L recombinant proteins has garnered significant attention due to their potential applications in understanding immune system dynamics and developing therapeutic strategies for various diseases, including autoimmune disorders, allergies, and cancer. Researchers have focused on the structure-function relationship of L-selectin, investigating how its various domains contribute to its adhesion properties. Additionally, recombinant L-selectin proteins serve as valuable tools in experimental settings, allowing for the study of its interactions with ligands and the design of inhibitors that could modulate immune responses. The generation of these recombinant proteins has enabled detailed investigations into the mechanisms of leukocyte trafficking and has opened avenues for novel therapeutic interventions aimed at modulating immune cell behavior in different pathological contexts.











