Cat: IPD-X22123

Recombinant Human EpCAM/TROP1 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EpCAM/TROP1

  • 简介

    The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. EpCAM/TROP1 Protein, Human (HEK293, His) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by the ability of the immobilized protein to support the adhesion of the L929 cells mouse fibroblast cell line. The ED50 for this effect is 0.7677 μg/mL, corresponding to a specific activity is 1.3×103 units/mg. Measured by the ability of the immobilized protein to support the adhesion of the L929 cells mouse fibroblast cell line. The ED50 for this effect is 0.7677 μg/mL, corresponding to a specific activity is 1.3×103 units/mg.

  • Alternative Names

    17-1A; 323/A3; ACSTD1; CD326; EGP-2; EGP314; EGP40; EpCAM; MOC31; TACST-1; TACSTD1; TROP1;

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    AAH14785.1

  • Expression Region

    Q24-K265

  • AA Sequence

    QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

  • Protein Length

    Partial

  • Molecular Weight

    34-42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on EpCAM (Epithelial Cell Adhesion Molecule) and TROP-1 (Tumor-Related Protein 1) recombinant proteins has gained significant attention due to their critical roles in cancer biology and potential as therapeutic targets. EpCAM is a transmembrane glycoprotein highly expressed in various epithelial cancers, such as breast, colorectal, and lung cancer, and is associated with cell proliferation, differentiation, and adhesion. Its aberrant expression is often linked to tumor progression and metastasis, making it an attractive target for antibody-based therapies. Similarly, TROP-1, also known as TAG-72, is a tumor-associated glycoprotein found in several malignancies and serves as a marker for cancer diagnosis and treatment. The development of recombinant forms of these proteins allows for more detailed studies on their structure, function, and interaction with other cellular components. Moreover, these recombinant proteins can be utilized in the generation of specific antibodies or as part of immunotherapeutic strategies, enhancing the ability to target and eliminate cancer cells while sparing normal tissues. Overall, the exploration of EpCAM and TROP-1 recombinant proteins presents promising avenues for innovative cancer therapies and improved patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US