Recombinant Human RANKL/TNFSF11 Protein(HEK293)

RANKL/TNFSF11

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Human (HEK293) is a recombinant human RANKL (G64-D245) without any tag, which is produced in HEK293 cell[1][2].

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1.Immobilized human TNFSF11 at 2 μg/mL (100 μL/well) can bind human Osteoprotegerin-hFc and the EC50 is 5-40 ng/mL. 2. Measured by its ability to induce TRAP activity, inducing osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 1.5-19.69 ng/mL, corresponding to a specific activity is > 5.079×10^4 units/mg. 3. Loaded Narlumosbart (HY-P99966) on AHC2 biosensor, can bind RANKL/TNFSF11 Protein, Human (HEK293) with an affinity constant of <1.000E-11 M as determined in BLI assay. Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 19.69 ng/mL， corresponding to a specific activity is 5.079×104 units/mg. Loaded Narlumosbart (HY-P99966) on AHC2 biosensor, can bind RANKL/TNFSF11 Protein, Human (HEK293) with an affinity constant of <1.000E-11 M as determined in BLI assay.

Tumor necrosis factor ligand superfamily member 11; RANKL; CD254; ODF; OPGL; TNFSF11; TRANCE

Human

HEK293

Tag Free

Greater than 90% as determined by SDS-PAGE.

AAC51762.1

G64-D245

GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Partial

28.81 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.