Recombinant Human FCAR/CD89 Protein(HEK293), His

FCAR/CD89

The FCAR/CD89 protein is crucial and can specifically bind to the Fc region of immunoglobulin α to promote the production of cytokines. FCAR/CD89 binds to the Fc epsilon RI gamma 2 receptor, induces gamma 2 tyrosine phosphorylation, and is complexly involved in signaling pathways and immune responses. FCAR/CD89 Protein, Human (HEK293, His) is the recombinant human-derived FCAR/CD89 protein, expressed by HEK293 , with C-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Immunoglobulin Alpha Fc Receptor; IgA Fc Receptor; CD89; FCAR

Human

HEK293

C-6*His

Greater than 90% as determined by SDS-PAGE.

P24071-1

Q22-N227

QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN

Extracellular Domain

40 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.