Cat: IPD-X11022

Recombinant Rat IL-13Rα2 Protein (HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-13Rα2

  • 简介

    IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-13 receptor subunit alpha-2; IL-13R-alpha-2; IL-13RA2; CD213a2; IL13RA2; IL13R

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

  • Uniprot

    Q8VHK6

  • Expression Region

    L24-K336

  • AA Sequence

    LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVMDNFKECKLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWTEASYGIADEGSLGTKIQDMKCIYYNWQYLVCSWKPGKTVHSDTNYTMFFWYEGLDHALQCADYLQDNEKNVGCKLSNLDSSDYKDFFIRVNGSSKLEPIRSSYMVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPSCYTYEIVVREDDISWESATDKNDMKLKRRANESEDLCFFVRCKINIYCADDGIWSEWSEEECWEGYTGPDSK

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-13Rα2 (Interleukin-13 receptor alpha 2) is a receptor for interleukin-13 (IL-13), a cytokine implicated in various inflammatory and fibrotic diseases, as well as in tumor biology. The overexpression of IL-13Rα2 has been observed in several cancers, making it a potential target for therapeutic intervention. Unlike its counterpart IL-13Rα1, which participates in mediating IL-13 signaling leading to beneficial immune responses, IL-13Rα2 lacks a functional signaling domain and acts primarily as a decoy receptor, sequestering IL-13 and limiting its availability to IL-13Rα1. This paradoxical role urges the exploration of IL-13Rα2 as a biomarker for tumor progression and an attractive candidate for targeted therapies, including antibody-drug conjugates and adoptive cell therapies. Researchers have been developing recombinant forms of IL-13Rα2 to study its structure and function, as well as to explore its potential in diagnostic and therapeutic applications. These recombinant proteins enable investigations into binding affinities, receptor dimerization, and downstream signaling pathways, providing insights into how IL-13Rα2 modulates tumor microenvironments and influences immune responses. Understanding IL-13Rα2's role in both normal physiology and pathology is essential for harnessing its potential in clinical applications, thereby advancing cancer treatment strategies and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US