Cat: IPD-X19781

Recombinant Rat CD133/PROM1 Protein(HEK293), mFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD133/PROM1

  • 简介

    The CD133/PROM1 protein is critical for multiple processes including glomerular epithelial cell differentiation and retinal morphogenesis, showing biased expression in tissues such as lung and kidney. CD133/PROM1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD133/PROM1 protein, expressed by HEK293 , with N-mFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Prominin-1; Antigen AC133; CD133; PROM1; PROML1; MSTP061

  • Species

    Rat

  • Source

    HEK293

  • Tag

    N-mFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    NP_001103607.1

  • Expression Region

    N171-Y424

  • AA Sequence

    NQQTRTRIQRTQKLAESNYRDLRALLTEAPKQIDYILGQYNTTKNKAFSDLDSIDSVLGGRIKGQLKPKVTPVLEEIKAMATAIRQTKDALQNMSSSLKSLRDASTQLSTNLTSVRNSIENSLNSNDCASDPASKICDSLRPQLSNLGSNHNGSQLQSVDRELNTVNDVDRTDLESLVKRGYMSIDEIPNMIQNQTGDVIKDVKKTLDSVSSKVKNMSQSIPVEEVLLQFSHYLNDSNRYIHESLPRVEEYDSY

  • Protein Length

    Partial

  • Molecular Weight

    70-95 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD133, also known as PROM1, is a transmembrane glycoprotein prominently expressed in stem cells and certain types of cancer cells, making it a critical marker in cancer research and regenerative medicine. Its role in maintaining stem cell properties and regulating cell differentiation has piqued the interest of scientists aiming to understand its involvement in tumorigenesis and tissue regeneration. The presence of CD133+ cells in various tumors, such as glioblastoma and colorectal cancer, indicates its potential as a target for cancer therapies, particularly in the context of cancer stem cells that contribute to tumor recurrence and metastasis. Recombinant CD133/PROM1 proteins have been developed to facilitate the study of its biological functions and interactions at the molecular level, allowing researchers to elucidate signaling pathways and mechanisms of action. Additionally, these proteins can serve as valuable tools for developing diagnostic and therapeutic strategies, including the creation of targeted drugs and vaccines. Overall, the ongoing research on CD133/PROM1 recombinant proteins holds promise for advancing our understanding of stem cell biology and improving clinical outcomes in cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US