Analytical Data
-
Gene name
TIGIT
-
简介
TIGIT is a receptor of the Ig superfamily that plays a key role in restricting adaptive and innate immunity. TIGIT can be used as an immune modulator to inhibit the activity of T cells and NK cells, and also regulates the recognition of cancer cells. TIGIT consists of an extracellular immunoglobulin (Ig) variable domain, a type 1 transmembrane domain, and a cytoplasmic tail with two inhibitory motifs. TIGIT Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
T cell immunoreceptor with Ig and ITIM domains; TIGIT; VSIG9; VSTM3
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_015300911.1
-
Expression Region
K27-P209
-
AA Sequence
KPGFSETVFSHRLSFTVLSAVGYFRWQKRPHLLPVSPLGRSMRWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIGIT (T cell immunoreceptor with Ig and ITIM domains) is an immune checkpoint receptor predominantly expressed on T cells and natural killer (NK) cells, playing a crucial role in regulating immune responses. The increasing understanding of tumor immunology has highlighted TIGIT as a significant inhibitory molecule that can downregulate T cell activity and contribute to immune evasion by tumors. Research has shown that TIGIT interacts with its ligands—CD155 and CD112—which are often overexpressed in various cancers, resulting in diminished anti-tumor immunity. Consequently, TIGIT has emerged as a promising target for cancer immunotherapy. Recombination technology enables the production of TIGIT proteins, facilitating the exploration of its structure and function. Various studies have focused on generating soluble forms of TIGIT to evaluate their effects on immune cell regulation, elucidating mechanisms of action, and assessing their potential as therapeutic agents in combination with other checkpoint inhibitors. Understanding the role of TIGIT in shaping immune responses offers new avenues for enhancing the efficacy of cancer treatments and optimizing immune-based therapies. Thus, the ongoing research on TIGIT recombinant proteins is pivotal for developing innovative strategies to combat cancer by reinvigorating the immune system's ability to recognize and eliminate tumor cells.











