Cat: IPD-X21545

Recombinant Human Galectin-9/LGALS9 Protein, GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Galectin-9/LGALS9

  • 简介

    Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9 Protein, Human (GST) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by E. coli , with N-GST labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Galectin-9; Gal-9; Ecalectin; Tumor antigen HOM-HD-21; LGALS9; Gal-9delta5

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00182-2

  • Expression Region

    M1-T323

  • AA Sequence

    MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

  • Protein Length

    Full Length

  • Molecular Weight

    60.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Galectin-9, encoded by the LGALS9 gene, is a member of the galectin family, which are soluble beta-galactoside-binding lectins. It plays a pivotal role in various biological processes, including cell adhesion, immune regulation, and apoptosis. The interest in Galectin-9 has surged due to its involvement in diverse pathological conditions, such as autoimmune diseases, cancer, and infectious diseases. Research has demonstrated that Galectin-9 can modulate immune responses by influencing T cell activity and regulating the progression of inflammation. Its unique ability to interact with multiple glycoconjugates and its dual role as both a pro-inflammatory and anti-inflammatory mediator underscore the complexity of its function in vivo. The development of recombinant Galectin-9 proteins has facilitated advanced studies, enabling researchers to dissect its molecular mechanisms and explore its therapeutic potential. By producing recombinant LGALS9, scientists aim to investigate its role in modulating immune responses and its potential applications in cancer immunotherapy and other diseases. Understanding the nuances of Galectin-9's functions through recombinant protein studies can pave the way for novel therapeutic strategies, ultimately contributing to better disease management and treatment outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US