Cat: IPD-X19415

Recombinant Rhesus Macaque CD19 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD19

  • 简介

    CD19 is a signaling component of the B-cell receptor complex that lowers the threshold for antigen-driven activation. CD19 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque CD19 is present at 2 μg/mL, can bind Recombinant biotinylated Human CD81 (HY-P74264). The ED50 for this effect is 23.93 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque CD19 is present at 2 μg/mL, can bind Recombinant biotinylated Human CD81 (HY-P74264). The ED50 for this effect is 23.93 μg/mL.

  • Alternative Names

    B-lymphocyte antigen CD19; CD19; B-lymphocyte surface antigen B4

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    F7F486

  • Expression Region

    Q21-K292

  • AA Sequence

    QEPLVVKVEEGDNAVLQCLEGTSDGPTQQLVWCRDSPFEPFLNLSLGLPGMGIRMGPLGIWLLIFNVSNQTGGFYLCQPGLPSEKAWQPGWTVSVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLNSSQLYVWAKDRPEMWEGEPVCGPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKGPKSSLLSLELKDDRPDRDMWVVDTGLLLTRATAQDAGKYYCHRGNWTKSFYLEITARPALWHWLLRIGGWK

  • Protein Length

    Partial

  • Molecular Weight

    44-75 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD19 is a critical protein that serves as a pan-B cell marker and plays a pivotal role in B cell development, activation, and differentiation. Its significance in the context of immunotherapy, particularly in the treatment of B cell malignancies such as leukemia and lymphoma, has spurred extensive research into CD19-targeted therapies. The advent of chimeric antigen receptor (CAR) T-cell therapy has highlighted the therapeutic potential of engineering T cells to express receptors that specifically target CD19, leading to remarkable clinical outcomes. However, there are challenges, including antigen escape and the development of resistance, which necessitate the exploration of CD19 as a recombinant protein for understanding its structural and functional properties. Researchers are focusing on producing CD19 recombinant proteins to analyze their binding affinities, elucidating the mechanisms of immune evasion, and developing improved therapeutic strategies. Additionally, the study of CD19's signaling pathways and its interactions with other molecules in the immune system may provide insights into enhancing the efficacy and safety of CD19-targeted therapies. Through these investigations, the ultimate goal is to refine existing treatment modalities and contribute to the advancement of personalized medicine in oncology, offering new hope for patients with B cell-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US