Recombinant Rhesus Macaque CD84/SLAMF5 Protein(HEK293), His

CD84/SLAMF5

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured in a cell proliferation assay using PHA stimulated Jurkat cells in the presence of anti-CD3. The ED50 for this effect is 1.389 μg/mL in the presence of anti-CD3 immobilized at 2μg/mL, corresponding to a specific activity is 719.942 units/mg. Measured in a cell proliferation assay using PHA stimulated Jurkat cells in the presence of anti-CD3. The ED50 for this effect is 1.389 μg/mL in the presence of anti-CD3 immobilized at 2μg/mL, corresponding to a specific activity is 719.942 units/mg.

SLAM family member 5; CD84; Ly-9B; SLAMF5

Rhesus Macaque

HEK293

C-6*His

Greater than 90% as determined by SDS-PAGE.

F6QA53

K22-R220

KDSEIITVNGILGESVTFPVNIQEPQQVTNIAWTSKTSVAYVTPGDSEMAPIVAVTHRNYYERIHALGPKYDLVISDLRMEDAGDYKADINTQAEPYTTTKRYNLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEEQELTYTCTAQNPVSNNSDSISARQLCADIAMGLR

Partial

35-50 kDa.

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.