Analytical Data
-
Gene name
KIR2DL3
-
简介
KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43628-1
-
Expression Region
H22-H245
-
AA Sequence
HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DL3, part of the Killer Immunoglobulin-like Receptor (KIR) family, is a significant receptor expressed on natural killer (NK) cells and certain T cells, playing a pivotal role in the immune response against infections and tumors. Its primary function involves recognizing specific ligands on target cells, particularly HLA-C molecules, which helps regulate NK cell activity and contributes to immune tolerance and surveillance. The study of KIR2DL3 has gained attention due to its implications in various health conditions, including autoimmune diseases, organ transplantation compatibility, and cancer immunotherapy. Researchers are particularly interested in understanding the structural and functional aspects of KIR2DL3 reconstituted proteins to elucidate the receptor's signaling pathways and its interactions with ligands. This can provide valuable insights into how variations in KIR2DL3 affect immune responses across different populations and genetic backgrounds. Additionally, the development of KIR2DL3 recombinant proteins facilitates the exploration of potential therapeutic applications, including the design of tailored immunotherapies that enhance NK cell activity against tumors. As KIR2DL3's diverse roles in immunity are unraveled, it holds promise for advancing personalized medicine approaches that leverage immune modulation for better disease outcomes.











