Analytical Data
-
Gene name
KIR3DL3/CD158z
-
简介
KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5 μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 39.78ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 39.78ng/mL.
-
Alternative Names
Killer cell immunoglobulin-like receptor 3DL3; CD158Z; KIR3DL7; KIRC1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8N743
-
Expression Region
Q26-L322
-
AA Sequence
QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL
-
Protein Length
Extracellular Domain
-
Molecular Weight
40-50 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR3DL3, also known as CD158z, is a member of the killer immunoglobulin-like receptor (KIR) family, which plays a crucial role in the regulation of immune responses, particularly in the context of natural killer (NK) cells and T lymphocytes. This receptor is expressed on the surface of certain immune cells and is known to interact with human leukocyte antigen (HLA) class I molecules, influencing the ability of the immune system to distinguish between self and non-self. Research into KIR3DL3/CD158z has gained significant attention due to its potential implications in various diseases, including viral infections, autoimmune disorders, and cancer. Understanding the functional mechanisms and signaling pathways associated with KIR3DL3/CD158z can provide insights into immune evasion strategies employed by pathogens and tumor cells. Additionally, the study of this receptor can facilitate the development of novel therapeutic approaches, such as monoclonal antibodies or targeted therapies aimed at modulating its activity, thereby enhancing the immune response against malignant cells. As such, the exploration of KIR3DL3/CD158z recombinant proteins serves as a fundamental step in delineating its biological functions and therapeutic potential, contributing to advancements in immunology and personalized medicine.











