Cat: IPD-X36000

Recombinant Mouse LILRB4/CD85k/ILT3 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LILRB4/CD85k/ILT3

  • 简介

    The LILRB4/CD85k/ILT3 protein is a multifaceted inhibitory receptor in immune regulation that significantly downregulates multiple immune responses. As a receptor for FN1 and integrin ITGAV/ITGB3, LILRB4/ILT3 inhibits IgE-mediated mast cell activation, KITLG/SCF-mediated mast cell activation, and antibody production by memory/marginal zone B cells through the ITGAV/ITGB3 interaction. LILRB4/CD85k/ILT3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LILRB4/CD85k/ILT3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Leukocyte immunoglobulin-like receptor subfamily B member 4; CD85k; Lilrb4; Gp49b

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q64281

  • Expression Region

    G24-K238

  • AA Sequence

    GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    35-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LILRB4, also known as CD85k or ILT3 (Immunoglobulin-like transcript 3), is a member of the leukocyte immunoglobulin-like receptor (LILR) family, which plays a crucial role in regulating immune responses. This receptor is predominantly expressed on myeloid cells, including dendritic cells and macrophages, and is involved in inhibitory signaling pathways that modulate T cell activation and maintain immune tolerance. Its significance has been underscored in various studies linking LILRB4 to processes such as tumor immune evasion, autoimmune diseases, and chronic infections. The expression of LILRB4 on tumor-associated macrophages facilitates the suppression of anti-tumor immunity, making it a subject of interest in cancer immunotherapy. Additionally, recombinant LILRB4/CD85k/ILT3 proteins have been developed for research purposes to better understand their structural and functional properties, as well as their interactions with ligands. Investigating the role of this receptor can provide insights into novel therapeutic targets for modulating immune responses and enhancing the efficacy of immunotherapies. Understanding the mechanisms through which LILRB4 operates not only aids in deciphering its biological functions but also paves the way for novel approaches to address immune-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US