Cat: IPD-X35978

Recombinant Human LILRA6/CD85b/ILT8 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LILRA6/CD85b/ILT8

  • 简介

    LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT8 Protein, Human (HEK293, N-His) is the recombinant human-derived LILRA6/CD85b/ILT8 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 0.2214 μg/ml, corresponding to a specific activity is 4.52×103 units/mg. Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 0.2214 μg/mL, corresponding to a specific activity is 4.52×103 units/mg.

  • Alternative Names

    Leukocyte immunoglobulin-like receptor subfamily A member 6; LILRA6; Immunoglobulin-like transcript 8; ILT-8; Leukocyte Ig-like receptor; ILT8; Leukocyte Immunoglobulin-like Receptor A6

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q6PI73-1

  • Expression Region

    G24-N447

  • AA Sequence

    GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    55-85 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LILRA6, also known as CD85b or ILT8, is a member of the leukocyte immunoglobulin-like receptor (LILR) family, which plays a critical role in the immune system regulation. As an inhibitory receptor expressed on various immune cells, including monocytes and dendritic cells, LILRA6 is involved in modulating immune responses by recognizing major histocompatibility complex (MHC) class I molecules and other ligands. Recent research has highlighted its potential role in influencing tolerance and promoting immune evasion in certain diseases, including cancer and autoimmune disorders. The recombinant protein form of LILRA6 has been developed to facilitate in-depth studies into its structural characteristics and function, enabling researchers to explore its binding interactions and signaling pathways. Understanding the mechanisms by which LILRA6 operates could lead to novel therapeutic approaches to manipulate immune responses, enhance vaccine efficacy, or develop immunotherapies for challenging conditions like tumor immunology. Thus, the investigation of LILRA6/CD85b/ILT8 is of paramount importance for both fundamental immunology and clinical applications in improving health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US