Recombinant Human LILRA1/LIR-6/CD85i Protein (HEK293)，His

LILRA1/LIR-6/CD85i

LILRA1/LIR-6/CD85i protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and possibly influencing immune activity. LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is the recombinant human-derived LILRA1/LIR-6/CD85i protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. Immobilized Human LILRA1 at 2 μg/mL (100 μL/well) can bind Human ANGPTL7, The ED50 for this effect is 1.143 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Human LILRA1 at 2 μg/mL (100 μL/well) can bind Human ANGPTL7, The ED50 for this effect is 1.143 μg/mL.

Leukocyte immunoglobulin-like receptor subfamily A member 1; CD85 antigen-like family member I

Human

HEK293

C-His

Greater than 95% as determined by SDS-PAGE.

O75019-1

P17-N461

PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN

Extracellular Domain

70-75 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.