Cat: IPD-X35837

Recombinant Rhesus Macaque Siglec-3/CD33 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Siglec-3/CD33

  • 简介

    Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Myeloid Cell Surface Antigen CD33; Siglec-3; gp67; CD33; SIGLEC3

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A2K5W2R5

  • Expression Region

    M16-G248

  • AA Sequence

    MDPRVRLEVQESVTVQEGLCVLVPCTFFHPVPYHTRNSPVHGYWFREGAIVSLDSPVATNKLDQEVREETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMEKGSTKYSYKSTQLSVHVTDLTHRPQILIPGALDPDHSKNLTCSVPWACEQGTPPIFSWMSAAPTSLGLRTTHSSVLIITPRPQDHGTNLTCQVKFPGAGVTTERTIQLNVSYASQNPRTDIFLGDGSG

  • Protein Length

    Partial

  • Molecular Weight

    45.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Siglec-3, also known as CD33, is a member of the sialic acid-binding immunoglobulin-like lectin (Siglec) family and plays a crucial role in the immune system by regulating sialic acid recognition and modulating immune cell signaling. Research into Siglec-3/CD33 has intensified due to its implications in various diseases, particularly in the context of hematological malignancies such as acute myeloid leukemia (AML) and its potential as a therapeutic target. CD33 is primarily expressed on myeloid lineage cells and is involved in inhibiting immune responses through its receptor-ligand interactions. The exploration of recombinant CD33 proteins has facilitated the understanding of its structure, function, and interactions with ligands, opening avenues for developing targeted therapies, such as monoclonal antibodies and immunotherapeutics that can selectively engage CD33-expressing cells. Additionally, its role in modulating immune cell activity makes it a candidate for combination therapies to enhance anti-tumor immunity. Ongoing studies are focused on elucidating the precise mechanisms by which Siglec-3/CD33 influences immune responses and identifying biomarkers for patient stratification in CD33-targeted therapies. This research background underscores the importance of Siglec-3/CD33 in both basic immunology and clinical applications, highlighting its potential as a pivotal player in the treatment of immune-related disorders and cancers.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US