Analytical Data
-
Gene name
Siglec-3/CD33
-
简介
Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, hFc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
1.Immobilized Human Siglec-3 at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Biotinylated Anti-Siglec-3 Antibody, hFc Tag with the EC50 of 21.8 ng/mL determined by ELISA. 2.Immobilized Human CD33 at 2 μg/mL (100 μL/well) can bind Anti-CD33 Antibody, the ED50 for this effect is 8.312 ng/mL. Immobilized Human CD33 at 2 μg/mL (100 μL/well) can bind Anti-CD33 Antibody, The ED50 for this effect is 8.312 ng/mL.
-
Alternative Names
Myeloid Cell Surface Antigen CD33; Siglec-3; gp67; CD33; SIGLEC3
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20138-1
-
Expression Region
D18-H259
-
AA Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
-
Protein Length
Extracellular Domain
-
Molecular Weight
68-80 kDa (glycosylation)
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Siglec-3, also known as CD33, is a member of the sialic acid-binding immunoglobulin-like lectin (Siglec) family and plays a crucial role in the immune system by regulating sialic acid recognition and modulating immune cell signaling. Research into Siglec-3/CD33 has intensified due to its implications in various diseases, particularly in the context of hematological malignancies such as acute myeloid leukemia (AML) and its potential as a therapeutic target. CD33 is primarily expressed on myeloid lineage cells and is involved in inhibiting immune responses through its receptor-ligand interactions. The exploration of recombinant CD33 proteins has facilitated the understanding of its structure, function, and interactions with ligands, opening avenues for developing targeted therapies, such as monoclonal antibodies and immunotherapeutics that can selectively engage CD33-expressing cells. Additionally, its role in modulating immune cell activity makes it a candidate for combination therapies to enhance anti-tumor immunity. Ongoing studies are focused on elucidating the precise mechanisms by which Siglec-3/CD33 influences immune responses and identifying biomarkers for patient stratification in CD33-targeted therapies. This research background underscores the importance of Siglec-3/CD33 in both basic immunology and clinical applications, highlighting its potential as a pivotal player in the treatment of immune-related disorders and cancers.











