Cat: IPD-X21322

Recombinant Cynomolgus B7-H6 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B7-H6

  • 简介

    B7-H6 Protein is a member of B7 family that serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors. In addition, B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Natural cytotoxicity triggering receptor 3 ligand 1; B7-H6; NCR3LG1

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    XP_005578557

  • Expression Region

    D25-D259

  • AA Sequence

    DLKVEMMARGIQATRLNDSVTISCKVIYSQPLNITSMGITWFRKSLTLDKEVKVFEFFGDHQKAFRPGANVSLWRLKSGDASLKLPGVQLEEAGEYRCEVVVTPLKAQGTVQLKVVASPTSRLFQDQAVVKENEGKYMCESSRFYPKDINITWEKWTQKSPHHVVISENVITGPTIKNMDGTFNITSYLKLNSSQEDPGTVYRCVIRHESLHTPVSIDFILTAPQQSLSEPEKTD

  • Protein Length

    Partial

  • Molecular Weight

    41-52 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B7-H6 is a member of the B7 family of immune regulatory molecules and has garnered significant interest in immunology due to its role as a ligand for the activating receptor NKp30 on natural killer (NK) cells. Interestingly, B7-H6 is specifically expressed on tumor cells and is largely absent in normal tissues, making it a potential target for cancer immunotherapy. The interaction between B7-H6 and NKp30 not only stimulates NK cell activation but also enhances the antitumor immune response, highlighting B7-H6's potential in tumor immunology. Researchers are investigating the functional properties and structural characteristics of B7-H6 recombinant proteins to better understand its mechanism of action and therapeutic potential. By producing recombinant B7-H6, scientists aim to develop novel immunotherapeutic strategies that can enhance NK cell responses against various malignancies. Moreover, studying recombinant B7-H6 facilitates the exploration of its signaling pathways and interactions with other immune cell types, thereby broadening our understanding of the tumor microenvironment and immune evasion mechanisms. In summary, the investigation of B7-H6 recombinant proteins represents a promising avenue in the field of cancer research and immune modulation, offering insights into innovative approaches for cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US