Analytical Data
-
Gene name
B7-H6
-
简介
B7-H6 Protein is a member of B7 family that serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors. In addition, B7-H6 promotes tumorigenesis via apoptosis inhibition, proliferation and immunological progression. B7-H6 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Natural cytotoxicity triggering receptor 3 ligand 1; B7-H6; NCR3LG1
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_005578557
-
Expression Region
D25-D259
-
AA Sequence
DLKVEMMARGIQATRLNDSVTISCKVIYSQPLNITSMGITWFRKSLTLDKEVKVFEFFGDHQKAFRPGANVSLWRLKSGDASLKLPGVQLEEAGEYRCEVVVTPLKAQGTVQLKVVASPTSRLFQDQAVVKENEGKYMCESSRFYPKDINITWEKWTQKSPHHVVISENVITGPTIKNMDGTFNITSYLKLNSSQEDPGTVYRCVIRHESLHTPVSIDFILTAPQQSLSEPEKTD
-
Protein Length
Partial
-
Molecular Weight
41-52 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B7-H6 is a member of the B7 family of immune regulatory molecules and has garnered significant interest in immunology due to its role as a ligand for the activating receptor NKp30 on natural killer (NK) cells. Interestingly, B7-H6 is specifically expressed on tumor cells and is largely absent in normal tissues, making it a potential target for cancer immunotherapy. The interaction between B7-H6 and NKp30 not only stimulates NK cell activation but also enhances the antitumor immune response, highlighting B7-H6's potential in tumor immunology. Researchers are investigating the functional properties and structural characteristics of B7-H6 recombinant proteins to better understand its mechanism of action and therapeutic potential. By producing recombinant B7-H6, scientists aim to develop novel immunotherapeutic strategies that can enhance NK cell responses against various malignancies. Moreover, studying recombinant B7-H6 facilitates the exploration of its signaling pathways and interactions with other immune cell types, thereby broadening our understanding of the tumor microenvironment and immune evasion mechanisms. In summary, the investigation of B7-H6 recombinant proteins represents a promising avenue in the field of cancer research and immune modulation, offering insights into innovative approaches for cancer treatment.











