Analytical Data
-
Gene name
BTN3A3
- Application
-
Alternative Names
rHuBTN3A3, His; Butyrophilin subfamily 3 member A3; BTN3A3
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00478
-
Expression Region
Q30-W248
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWHHHHHH
-
Protein Length
Extracellular Domain
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTN3A3, a member of the butyrophilin (BTN) family, has gained attention in immunological research due to its role in the modulation of immune responses. This protein is predominantly expressed in antigen-presenting cells and has been implicated in the regulation of T cell activation and differentiation. Its unique structure, featuring immunoglobulin-like domains, allows BTN3A3 to interact with various receptors on T cells, potentially influencing their activation thresholds. Recent studies have suggested that BTN3A3 may play a significant role in the presentation of non-peptide antigens, which challenges traditional notions of T cell activation that primarily focus on peptide-MHC interactions. This presents an exciting avenue for vaccine development and immunotherapy approaches, particularly in cancer where manipulating T cell responses can improve therapeutic outcomes. Research into recombinant BTN3A3 has been initiated to further elucidate its functional properties, explore its potential as a biomarker for disease, and investigate its applications in targeted therapies. These efforts are critical, given the increasing evidence linking BTN3A3 to various pathological conditions, including autoimmune diseases and cancers, suggesting that a deeper understanding of this protein could lead to novel therapeutic strategies that harness the power of the immune system.
