Analytical Data
-
Gene name
B7-1/CD80
-
简介
CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
T-lymphocyte activation antigen CD80; Activation B7-1 antigen; B7; CD80
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
G7NXN7
-
Expression Region
V35-N242
-
AA Sequence
VATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN
-
Protein Length
Partial
-
Molecular Weight
35-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B7-1/CD80 is a crucial costimulatory molecule that plays a significant role in the regulation of T cell activation and immune response. It is expressed on the surface of antigen-presenting cells (APCs) and binds to CD28 and CTLA-4 on T cells, thereby influencing their proliferation and differentiation. The importance of the B7-1/CD80 pathway in immune modulation has been recognized in various contexts, including cancer immunotherapy, autoimmunity, and infectious diseases. Research has shown that enhancing B7-1/CD80 interactions can provide a robust activation signal to T cells, making it a potential target for therapeutic strategies aimed at boosting anti-tumor immunity or reversing T cell tolerance in chronic infections. Additionally, the recombinant form of B7-1/CD80 has been developed to better understand its functional properties and mechanisms of action. This includes structural studies and functional assays that aim to dissect the complex interactions between B7-1/CD80 and its receptors. By exploring these molecular dynamics, scientists hope to uncover new insights that can lead to improved immunotherapeutic approaches, as well as better management of immune-related disorders. The continued investigation into B7-1/CD80 not only enhances our fundamental understanding of immune regulation but also holds promise for the development of innovative interventions in the fields of immunology and oncology.











