Analytical Data
-
Gene name
CD55/DAF
-
简介
The CD55/DAF protein is critical in the immune system and recognizes C4b and C3b fragments. It interacts with cell-associated C4b and C3b, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. CD55/DAF Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD55/DAF protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Complement Decay-Accelerating factor; CD55; CR; DAF
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q61475
-
Expression Region
D35-T361
-
AA Sequence
MIRGRAPRTRPSPPPPLLPLLSLSLLLLSPTVRGDCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT
-
Protein Length
Partial
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD55, also known as decay-accelerating factor (DAF), is a critical regulator of the complement system, playing a vital role in protecting host cells from complement-mediated lysis. It acts by accelerating the decay of C3 and C5 convertases, thus inhibiting the amplification of the complement cascade. The dysregulation of CD55/DAF has been implicated in various pathological conditions, including autoimmune diseases, organ transplantation, and cancer. For instance, tumors often exploit CD55 to evade immune surveillance, leading to tumor progression and poor patient outcomes. Given its pivotal role in immune regulation, recombinant CD55/DAF proteins have become a focal point of research, with potential therapeutic applications targeting complement-related diseases and enhancing the efficacy of cancer immunotherapies. Recent studies have focused on the production, characterization, and functional evaluation of recombinant CD55 proteins, aiming to elucidate their mechanisms of action and therapeutic potential. Advances in recombinant DNA technology and protein engineering have facilitated the generation of active CD55 variants, which can be coupled with various delivery systems for targeted therapy. This research not only contributes to a better understanding of the complement system but also opens new avenues for developing innovative treatments that leverage the protective properties of CD55/DAF against various diseases. Overall, the study of CD55/DAF as a recombinant protein holds promise for enhancing therapeutic strategies in immunology and oncology.











