Analytical Data
-
Gene name
CD14
-
简介
CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED50 this effect is 468.3 ng/mL, corresponding to a specific activity is 2135.38 U/mg. Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL -2 cells. The ED50 this effect is 468.3 ng/ml, corresponding to a specific activity is 2135.38 U/mg.
-
Alternative Names
Monocyte Differentiation Antigen CD14; CD14
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc;C-His;C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10810
-
Expression Region
S16-P345
-
AA Sequence
SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP
-
Protein Length
Partial
-
Molecular Weight
85-95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD14 is a glycoprotein primarily expressed on the surface of monocytes and macrophages, playing a critical role in the immune response by functioning as a co-receptor for the detection of bacterial lipopolysaccharides (LPS). As part of the innate immune system, CD14 aids in the recognition of pathogens, facilitating the activation of various immune pathways, including the production of pro-inflammatory cytokines. The study of CD14 recombinant protein has garnered significant attention due to its potential applications in immunology and therapeutic interventions. Researchers have explored its role in modulating immune responses, its interaction with other receptors, and its participation in various inflammatory diseases. By generating recombinant CD14, scientists can investigate its biochemical properties, assess its binding affinities, and evaluate its effects on immune cell activation. Furthermore, CD14's involvement in conditions such as sepsis, chronic inflammatory diseases, and autoimmune disorders highlights its clinical relevance, paving the way for potential therapeutic strategies. The advancement of recombinant technology has enabled more efficient production of CD14 protein, allowing for detailed studies and the development of CD14-based therapies or diagnostics, thus providing valuable insights into immune regulation and potential treatments for inflammatory diseases.











