Cat: IPD-X20848

Recombinant Mouse CD14 Protein(HEK293), hFc & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD14

  • 简介

    CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL-2 cells. The ED50 this effect is 468.3 ng/mL, corresponding to a specific activity is 2135.38 U/mg. Measured by its ability to enhance LPS-induced IL-6 secretion by CTLL -2 cells. The ED50 this effect is 468.3 ng/ml, corresponding to a specific activity is 2135.38 U/mg.

  • Alternative Names

    Monocyte Differentiation Antigen CD14; CD14

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc;C-His;C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10810

  • Expression Region

    S16-P345

  • AA Sequence

    SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP

  • Protein Length

    Partial

  • Molecular Weight

    85-95 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD14 is a glycoprotein primarily expressed on the surface of monocytes and macrophages, playing a critical role in the immune response by functioning as a co-receptor for the detection of bacterial lipopolysaccharides (LPS). As part of the innate immune system, CD14 aids in the recognition of pathogens, facilitating the activation of various immune pathways, including the production of pro-inflammatory cytokines. The study of CD14 recombinant protein has garnered significant attention due to its potential applications in immunology and therapeutic interventions. Researchers have explored its role in modulating immune responses, its interaction with other receptors, and its participation in various inflammatory diseases. By generating recombinant CD14, scientists can investigate its biochemical properties, assess its binding affinities, and evaluate its effects on immune cell activation. Furthermore, CD14's involvement in conditions such as sepsis, chronic inflammatory diseases, and autoimmune disorders highlights its clinical relevance, paving the way for potential therapeutic strategies. The advancement of recombinant technology has enabled more efficient production of CD14 protein, allowing for detailed studies and the development of CD14-based therapies or diagnostics, thus providing valuable insights into immune regulation and potential treatments for inflammatory diseases.


E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US