Analytical Data
-
Gene name
PDGF R alpha
-
简介
PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGF R beta Protein, Rat (HEK293, Fc) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
Platelet-derived growth factor receptor beta; PDGF-R-beta; PDGFR-1; CD140b; PDGFRB
-
Species
Rat
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05030
-
Expression Region
L32-K530
-
AA Sequence
LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFK
-
Protein Length
Extracellular Domain
-
Molecular Weight
117 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Platelet-derived growth factor receptor alpha (PDGF Rα) plays a crucial role in various cellular processes, including proliferation, migration, and survival, making it significant in developmental biology and tissue repair. It is primarily involved in mediating the effects of PDGF, a potent mitogen that regulates cell growth and angiogenesis. Research into PDGF Rα has gained momentum due to its implication in several pathologies, particularly in fibrotic diseases, atherosclerosis, and cancers, where abnormal PDGF signaling contributes to disease progression. The production of recombinant PDGF Rα proteins allows for detailed studies of its structure, function, and interactions at a molecular level. These recombinant proteins are essential for elucidating the receptor's role in signaling pathways and understanding how its dysregulation can lead to oncogenesis and other disorders. Additionally, the use of PDGF Rα as a therapeutic target is under investigation, as inhibiting its signaling may provide new avenues for treating diseases linked to abnormal cell proliferation and migration. Overall, the research on recombinant PDGF Rα not only enhances our understanding of fundamental biological processes but also opens up potential therapeutic strategies aimed at modulating its activity in various diseases.











