Analytical Data
-
Gene name
SLAMF8
-
简介
SLAMF8 protein may contribute to B-lineage commitment and modulation of B-cell receptor signaling, playing a crucial role in B-cell development and immune responses. Exploring its molecular mechanisms and downstream effects could provide insights into its significance in B-cell biology. SLAMF8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF8 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
SLAM family member 8; B-lymphocyte activator macrophage expressed; CD353; Slamf8; Blame
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9D3G2
-
Expression Region
V21-D231
-
AA Sequence
VQVLSKVGDSELLVAECPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRVQLYDNLSLELGPLKPGDSGNFSVLMVDTGGQTWTQTLYLKVYDAVPKPEVQVFTAAAEETQPLNTCQVFLSCWAPNISDITYSWRWEGTVDFNGEVRSHFSNGQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASGKASYKD
-
Protein Length
Extracellular Domain
-
Molecular Weight
32-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLAMF8 (Signaling Lymphocytic Activation Molecule Family Member 8) is a member of the SLAM family of proteins, which are involved in immune responses. It primarily functions as an immune regulator, influencing the activation, differentiation, and survival of various immune cells, including T cells and dendritic cells. Recent studies have highlighted the potential role of SLAMF8 in autoimmune diseases and infections; however, its precise mechanisms and interactions within the immune system are not fully understood. Due to its importance in immune regulation, researchers have shown interest in characterizing SLAMF8 through recombinant protein studies. By expressing and purifying SLAMF8 as a recombinant protein, scientists aim to investigate its structural properties, binding interactions, and functional roles in immune signaling pathways. This research could provide valuable insights into how SLAMF8 contributes to immune responses and its potential as a therapeutic target for immune-related disorders. Understanding SLAMF8's function may pave the way for new strategies in treating autoimmune diseases and improving immune system function.











