Cat: IPD-X18719

Recombinant Mouse FCRL1 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCRL1

  • 简介

    Fc receptor-like protein 1 (Fcrl1) is a cell-surface membrane protein that belongs to FCRL family. Fcrl1 is a BCR co-receptor and enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization. Fcrl1 is a biomarker and an important target in B cell lymphoproliferative disorders[1][2][3]. FCRL1 Protein, Mouse (203a.a, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Fc receptor-like protein 1; FcRL1; FcRH1; hIFGP1; CD307a; FCRH1; IFGP1; IRTA5

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A0R4J0W8

  • Expression Region

    A17-S219

  • AA Sequence

    AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLS

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    40-54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FCRL1, or Fc receptor-like 1, is a member of the Fc receptor family, which plays a pivotal role in the immune response regulation, particularly in the context of B cell development and function. Characterized by its unique extracellular features, FCRL1 is predominantly expressed on B cells and has been implicated in modulating T cell activation and antibody responses. Research has increasingly focused on FCRL1’s function in various immunological contexts, including autoimmunity and cancer, as it may influence the balance between tolerance and immune activation. Studies have shown that the expression levels of FCRL1 can vary significantly in different diseases, indicating its potential as a biomarker for disease progression or therapeutic response. Furthermore, understanding the structural dynamics of FCRL1 through recombinant protein studies can provide insights into its receptor-ligand interactions and downstream signaling pathways, paving the way for novel therapeutic strategies. As such, the production and characterization of recombinant FCRL1 protein become crucial for elucidating its functional roles in immunology and for exploring its potential applications in targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US