Analytical Data
-
Gene name
CD147
-
简介
Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen 尾-chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant SARS-COV-2 S Protein is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Cynomolgus CD147. The ED50 for this effect is 10.35 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant SARS-COV-2 S Protein is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Cynomolgus CD147. The ED50 for this effect is 10.35 μg/mL.
-
Alternative Names
Basigin; HT7 antigen; Membrane glycoprotein gp42; Bsg
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_005587354
-
Expression Region
A19-H209
-
AA Sequence
AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH
-
Protein Length
Partial
-
Molecular Weight
27-33 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD147, also known as basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. It plays a crucial role in various physiological and pathological processes, including cell proliferation, differentiation, and migration, primarily through its interaction with integrins and other proteins in the extracellular matrix. Research has increasingly focused on CD147 due to its implications in cancer progression, cardiovascular diseases, and inflammatory responses. In particular, CD147 is implicated in promoting tumor progression by enhancing matrix metalloproteinase (MMP) activity, facilitating tumor invasiveness and metastasis. The generation of recombinant CD147 proteins has emerged as a valuable tool for elucidating its functional roles and interactions in these processes. By producing CD147 in a controlled environment, researchers can investigate its structure-function relationships, binding properties, and potential as a therapeutic target. Furthermore, recombinant CD147 can be used in the development of diagnostic assays or targeted drug delivery systems, making it a focal point in both basic and translational research. Understanding CD147's mechanisms may pave the way for novel therapeutic strategies aimed at inhibiting its function in diseases characterized by aberrant cell signaling and extracellular matrix remodeling. Thus, the study of CD147 recombinant proteins not only enhances our comprehension of its biological significance but also contributes to the development of innovative approaches to tackle various diseases.
