Recombinant Rat CD117/c-Kit Protein(HEK293), His

CD117/c-Kit

CD117, also known as tyrosine-protein kinase KIT or mast/stem cell growth factor receptor (SCFR), is a cytokine receptor that is expressed on the surface of hematopoietic stem cells and other cell types. CD117 signaling pathway plays an important role in cell survival, proliferation and differentiation. CD117 is a proto-oncogene associated with tumor development. CD117/c-kit Protein, Rat (HEK293, His) is the recombinant rat-derived CD117/c-kit protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD117/c-kit is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 10.95 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat CD117/c-kit is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 10.95 ng/mL.

Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl

Rat

HEK293

C-10*His

Greater than 90% as determined by SDS-PAGE.

Q63116

Q26-T522

QPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTDPAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLVGLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYHRLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVSTSVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGSANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNRGEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTYDRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSIDSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHT

Partial

60-110 kDa.

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.