Cat: IPD-X18661

Recombinant Mouse CD117/c-Kit Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD117/c-Kit

  • 简介

    CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind BiotinylatedRecombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL.

  • Alternative Names

    Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P05532

  • Expression Region

    S25-T523

  • AA Sequence

    SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    70-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD117, also known as c-Kit, is a receptor tyrosine kinase that plays a crucial role in various biological processes, including cell survival, proliferation, and differentiation. It is predominantly expressed in hematopoietic stem cells, mast cells, and interstitial cells of Cajal, making it vital for normal physiological functions such as hematopoiesis and gastrointestinal motility. The study of CD117/c-Kit has significant implications in cancer research, particularly in understanding its mutation-driven malignancies like gastrointestinal stromal tumors (GISTs), where activating mutations lead to uncontrolled cell growth. Moreover, c-Kit is implicated in other cancer types, including melanoma and certain leukemias, highlighting its potential as a therapeutic target. Researchers have been focusing on developing recombinant proteins for c-Kit to elucidate its signaling pathways and investigate novel therapeutic strategies. These recombinant proteins can be utilized in assays to study interactions with downstream signaling molecules, assess the efficacy of small molecule inhibitors, and screen for c-Kit activating antibodies. Furthermore, elucidating the structure-function relationship of c-Kit through recombinant protein studies can aid in the design of more selective therapeutics aimed at targeting aberrant c-Kit signaling in cancer. Overall, the exploration of CD117/c-Kit recombinant proteins serves as a critical research avenue for advancing the understanding of its biological functions and developing targeted therapies for diseases associated with c-Kit dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US