Analytical Data
-
Gene name
CD117/c-Kit
-
简介
CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind BiotinylatedRecombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL.
-
Alternative Names
Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl
-
Species
Mouse
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05532
-
Expression Region
S25-T523
-
AA Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
-
Protein Length
Extracellular Domain
-
Molecular Weight
70-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD117, also known as c-Kit, is a receptor tyrosine kinase that plays a crucial role in various biological processes, including cell survival, proliferation, and differentiation. It is predominantly expressed in hematopoietic stem cells, mast cells, and interstitial cells of Cajal, making it vital for normal physiological functions such as hematopoiesis and gastrointestinal motility. The study of CD117/c-Kit has significant implications in cancer research, particularly in understanding its mutation-driven malignancies like gastrointestinal stromal tumors (GISTs), where activating mutations lead to uncontrolled cell growth. Moreover, c-Kit is implicated in other cancer types, including melanoma and certain leukemias, highlighting its potential as a therapeutic target. Researchers have been focusing on developing recombinant proteins for c-Kit to elucidate its signaling pathways and investigate novel therapeutic strategies. These recombinant proteins can be utilized in assays to study interactions with downstream signaling molecules, assess the efficacy of small molecule inhibitors, and screen for c-Kit activating antibodies. Furthermore, elucidating the structure-function relationship of c-Kit through recombinant protein studies can aid in the design of more selective therapeutics aimed at targeting aberrant c-Kit signaling in cancer. Overall, the exploration of CD117/c-Kit recombinant proteins serves as a critical research avenue for advancing the understanding of its biological functions and developing targeted therapies for diseases associated with c-Kit dysregulation.











