Cat: IPD-X20717

Recombinant Rat PD-L2 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PD-L2

  • 简介

    Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.Measured by its binding ability in a functional ELISA.Immobilized rat PDCD1LG2-His at 10 μg/mL (100 μl/well) can bind rat PDCD1-Fc, The EC50 of rat PDCD1-Fc is 15-35 ng/mL. 2.Measured by its binding ability in a functional ELISA. When Recombinant Rat PD-L2 is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Rat PD-1 that produces 50% optimal binding response is 0.2136 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat PD‑L2 is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Rat PD-1 that produces 50% optimal binding response is 0.2136 μg/mL.

  • Alternative Names

    Programmed cell death 1 ligand 2; PD-1 ligand 2; PD-L2; B7-DC; CD273

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    D4AAV6

  • Expression Region

    L20-R219

  • AA Sequence

    LFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPR

  • Protein Length

    Partial

  • Molecular Weight

    35.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PD-L2 (Programmed Death-Ligand 2) is a crucial immune checkpoint protein that plays a significant role in modulating the immune response, particularly in the context of cancer and autoimmune diseases. As a ligand for the PD-1 receptor, PD-L2 helps to inhibit T-cell activation and proliferation, thereby contributing to immune tolerance and the prevention of excessive tissue damage. The understanding of PD-L2's function has become increasingly relevant with the rise of immunotherapy, where inhibiting PD-1 or its ligands can enhance the body's immune response against tumors. Research into PD-L2, particularly in the development of recombinant proteins, has gained momentum as scientists aim to elucidate its structural and functional properties, which can lead to novel therapeutic approaches. Recombinant PD-L2 proteins are being studied for their potential use as biomarkers for immune status, as well as their ability to serve as targets for antibody-based therapies. Additionally, investigating PD-L2 interactions may provide insight into the mechanisms of immune evasion in cancers, enabling the design of more effective immunotherapeutic strategies. Overall, the study of PD-L2 recombinant proteins is a promising area of research that can contribute significantly to advances in cancer treatment and the understanding of immune regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US