Cat: IPD-X10801

Recombinant Pig IL-6 Protein , C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-6

  • 简介

    IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". Animal-Free IL-6 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-6; Interleukin HP-1; BSF2; HSF; IFNB2

  • Species

    Pig

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    P26893

  • Expression Region

    R31-M212

  • AA Sequence

    MGRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-6 (IL-6) is a multifunctional cytokine that plays a critical role in immune response, inflammation, and hematopoiesis. It is produced by various cell types, including T cells, macrophages, and fibroblasts, and its dysregulation is associated with numerous pathological conditions, such as autoimmune diseases, cancers, and chronic inflammatory disorders. Research into IL-6 has gained prominence due to its dual role as both a pro-inflammatory and anti-inflammatory mediator, which complicates its therapeutic targeting. Recombinant IL-6 proteins are essential tools for studying its biological effects and mechanisms of action. These proteins can be produced using recombinant DNA technology, allowing for the generation of large quantities of biologically active IL-6 for research purposes. Investigations involving IL-6 recombinant proteins have provided insights into signaling pathways, interactions with IL-6 receptors, and the cytokine’s role in disease processes. Furthermore, IL-6 has emerged as a potential therapeutic target, prompting the development of IL-6 inhibitors for treating various diseases, including rheumatoid arthritis and COVID-19. Understanding the structure-function relationship of IL-6 through recombinant protein studies is crucial for the design of effective interventions, making the research into IL-6 recombinant proteins a significant area in cellular and molecular biology, as well as in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US