Analytical Data
-
Gene name
4-1BBL/TNFSF9 Trimer
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Rat 4-1BB/TNFRSF9 is Immobilized at 100 ng/mL (100 µL/well), can bind Cynomolgus 4-1BB Ligand/TNFSF9. The ED50 for this effect is 2.665 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat 4-1BB/TNFRSF9 is Immobilized at 100 ng/mL (100 µL/well), can bind Cynomolgus 4-1BB Ligand/TNFSF9 .The ED50 for this effect is 2.665 ng/mL.
-
Alternative Names
Tumor necrosis factor ligand superfamily member 9; CD137L; 4-1BB Ligand
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_015296398
-
Expression Region
R68-E251
-
AA Sequence
REGPELSPDNPAGLLDLRQGMFAQLVAQNVLLTDGPLSWYSDPGLAGVSLAEGLSYKEDTKELVVAKAGVYYVFLQLMLQRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPSASSEARNSAFGFQGRLLHLGAGQRLGVHLHTEARACHAWQLTQGATVLGLFRVTPEVPAGLSSPRSE
-
Protein Length
Partial
-
Molecular Weight
47.8 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
4-1BBL (also known as TNFSF9) is a member of the TNF superfamily and plays a crucial role in immune regulation, particularly in T cell activation and proliferation. It is primarily expressed on antigen-presenting cells and binds to its receptor, 4-1BB (CD137), found on T cells, promoting their survival and enhancing immune responses. The therapeutic potential of targeting the 4-1BB/4-1BBL axis has garnered significant interest, particularly in cancer immunotherapy, as it can enhance the anti-tumor immune response. However, the use of 4-1BBL as a therapeutic agent has been limited by its stability and bioavailability in vivo. To address these challenges, researchers have been focusing on developing a recombinant 4-1BBL trimer, which is expected to enhance its functional activity and therapeutic efficacy by improving its interaction with the 4-1BB receptor. The trimeric form is anticipated to provide a more stable and potent stimulus for T cell activation compared to monomeric forms. This engineering approach is critical for harnessing the full potential of the 4-1BB/4-1BBL pathway in various therapeutic applications, including cancer treatment, where robust T cell activation is essential for effective tumor eradication. Thus, the study of recombinant 4-1BBL trimers is positioned at the forefront of immunotherapy research, aiming to create innovative solutions for enhancing immune responses against malignancies and potentially other diseases.
