Analytical Data
-
Gene name
HVEM/TNFRSF14
-
简介
HVEM (herpes virus entry mediator, TNFRSF14, CD270) is a member of the tumor necrosis factor receptor superfamily (TNFRSF). HVEM is a bidirectional molecular switch that transduces positive and negative signals. HVEM can deliver proinflammatory and survival signals when engaged by BTLA or LIGHT, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions. While, HVEM binds to CD160 and BTLA, inhibiting T- and B-lymphocyte activation and proliferation[2][3]. HVEM/TNFRSF14 Protein, Human (sf9, Fc) is a recombinant protein consisting of 146 amino acids (L39-K184) and is produced in sf9 insect cells.
- Application
-
Biological Activity
1.The ED50 < 0> 1.0 × 104 units/mg. 2. Immobilized HVEM, hFc, Human at 2.0 μg/mL (100 µl/well) can bind biotinylated human BTLA with a linear range of 0.39-3.13 μg/mL. 3. Immobilized HVEM, hFc, Human at 2.0 μg/mL (100 µl/well) can bind biotinylated CD160, hFc, Human with a linear range of 0.39-3.13 μg/mL.
-
Alternative Names
rHuHVEM, Fc Chimera; TNFRSF14; TR2; CD270; HVEA
-
Species
Human
-
Source
Baculovirus
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92956
-
Expression Region
L39-K184
-
AA Sequence
LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
-
Protein Length
Partial
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HVEM, also known as TNFRSF14 (Tumor Necrosis Factor Receptor Superfamily Member 14), is a critical member of the TNF receptor family that plays a significant role in regulating immune responses. It is primarily expressed in lymphocytes and serves as a receptor for several ligands, including LIGHT, BTLA, and lymphotoxin. The interaction between HVEM and its ligands is essential for modulating T-cell activation, proliferation, and apoptosis. Dysregulation of HVEM signaling has been implicated in various autoimmune diseases, cancers, and infections, highlighting its potential as a therapeutic target. Research on HVEM/TNFRSF14 recombinant proteins focuses on elucidating their structural and functional properties, which are crucial for understanding the mechanisms of immune modulation. This research often involves the production and characterization of recombinant HVEM proteins to explore their interactions with ligands and downstream signaling pathways, as well as their potential applications in disease treatment and vaccine development. By advancing our knowledge of HVEM biology, we can potentially discover novel strategies for enhancing immune responses or suppressing unwanted inflammation, thus paving the way for innovative therapies in oncology and immunology.











