Cat: IPD-X18504

Recombinant Human HVEM/TNFRSF14 Protein(Baculovirus), hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HVEM/TNFRSF14

  • 简介

    HVEM (herpes virus entry mediator, TNFRSF14, CD270) is a member of the tumor necrosis factor receptor superfamily (TNFRSF). HVEM is a bidirectional molecular switch that transduces positive and negative signals. HVEM can deliver proinflammatory and survival signals when engaged by BTLA or LIGHT, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions. While, HVEM binds to CD160 and BTLA, inhibiting T- and B-lymphocyte activation and proliferation[2][3]. HVEM/TNFRSF14 Protein, Human (sf9, Fc) is a recombinant protein consisting of 146 amino acids (L39-K184) and is produced in sf9 insect cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.The ED50 < 0> 1.0 × 104 units/mg. 2. Immobilized HVEM, hFc, Human at 2.0 μg/mL (100 µl/well) can bind biotinylated human BTLA with a linear range of 0.39-3.13 μg/mL. 3. Immobilized HVEM, hFc, Human at 2.0 μg/mL (100 µl/well) can bind biotinylated CD160, hFc, Human with a linear range of 0.39-3.13 μg/mL.

  • Alternative Names

    rHuHVEM, Fc Chimera; TNFRSF14; TR2; CD270; HVEA

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92956

  • Expression Region

    L39-K184

  • AA Sequence

    LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

  • Protein Length

    Partial

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HVEM, also known as TNFRSF14 (Tumor Necrosis Factor Receptor Superfamily Member 14), is a critical member of the TNF receptor family that plays a significant role in regulating immune responses. It is primarily expressed in lymphocytes and serves as a receptor for several ligands, including LIGHT, BTLA, and lymphotoxin. The interaction between HVEM and its ligands is essential for modulating T-cell activation, proliferation, and apoptosis. Dysregulation of HVEM signaling has been implicated in various autoimmune diseases, cancers, and infections, highlighting its potential as a therapeutic target. Research on HVEM/TNFRSF14 recombinant proteins focuses on elucidating their structural and functional properties, which are crucial for understanding the mechanisms of immune modulation. This research often involves the production and characterization of recombinant HVEM proteins to explore their interactions with ligands and downstream signaling pathways, as well as their potential applications in disease treatment and vaccine development. By advancing our knowledge of HVEM biology, we can potentially discover novel strategies for enhancing immune responses or suppressing unwanted inflammation, thus paving the way for innovative therapies in oncology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US