Analytical Data
-
Gene name
CD127/IL-7RA
-
简介
IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 216 amino acids (E21-G236)[1][2].
- Application
-
Alternative Names
Interleukin-7 receptor subunit alpha; Il7r; IL-7R subunit alpha; IL-7R-alpha; IL-7RA; CD127
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16871-1
-
Expression Region
E21-G236
-
AA Sequence
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSG
-
Protein Length
Extracellular Domain
-
Molecular Weight
40-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD127, also known as interleukin-7 receptor alpha (IL-7RA), plays a crucial role in the immune system, particularly in lymphocyte differentiation and homeostasis. It is a vital component of the IL-7 receptor complex, which mediates the effects of interleukin-7 (IL-7), a cytokine essential for T cell development and survival. Dysfunction in this receptor has been associated with various immunodeficiencies, autoimmune diseases, and even cancer, highlighting its significance in maintaining immune balance. Research into CD127/IL-7RA recombinant proteins has gained momentum as scientists seek to understand its structural and functional characteristics. By producing recombinant forms of the IL-7RA protein, researchers aim to investigate its interaction with IL-7 and its role in T cell maturation. These studies can provide insights into therapeutic applications, especially in designing targeted treatments for conditions like HIV/AIDS, where T cell depletion occurs, or in enhancing T cell responses in cancer immunotherapy. The development of CD127/IL-7RA recombinant proteins also opens avenues for producing monoclonal antibodies that could modulate immune responses. Overall, the exploration of CD127/IL-7RA recombinant proteins represents a significant step forward in immunological research, holding promise for novel immunotherapeutic strategies and a deeper understanding of immune regulation.











