Cat: IPD-X18467

Recombinant Human CRTAM/CD355 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRTAM/CD355

  • 简介

    The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Human (HEK293, His) is the recombinant human-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCytotoxic and regulatory T-cell molecule/CRTAM, His; Cytotoxic and Regulatory T-Cell Molecule; Class-I MHC-Restricted T-Cell-Associated Molecule; CD355; CRTAM

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95727-1

  • Expression Region

    S18-S286

  • AA Sequence

    SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    58-64 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRTAM (Cytotoxic T lymphocyte-associated protein 4 receptor) is a crucial immune regulatory protein that plays a significant role in T cell-mediated immune responses, particularly in the context of cancer and viral infections. CD355, another designation for CRTAM, is predominantly expressed on activated T cells and is involved in promoting T cell interactions with various immune cells, thereby enhancing immune activation and cytotoxicity. Research into CRTAM/CD355 recombinant proteins aims to elucidate their structure-function relationships, signaling pathways, and potential therapeutic applications in immunotherapy. The unique properties of CRTAM suggest that it may serve as a promising target for enhancing anti-tumor immunity. Furthermore, understanding the molecular mechanisms by which CRTAM/CD355 influences T cell behavior can provide vital insights into how to manipulate immune responses for improved therapeutic outcomes. Studies focusing on the generation of recombinant CRTAM/CD355 proteins will contribute to the development of innovative strategies for cancer treatment and vaccination approaches against chronic infections, underlining the importance of this research in the field of immunology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US