Analytical Data
-
Gene name
SIRP alpha/CD172a
-
简介
The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (HEK293, His) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Signal-regulatory protein alpha; CD172a; SIRP alpha; SIRPA; MFR; SHPS1; SIRP
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P97797-1/Q6P6I8
-
Expression Region
K32-N373
-
AA Sequence
KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN
-
Protein Length
Extracellular Domain
-
Molecular Weight
55-110 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIRP alpha (Signal Regulatory Protein alpha), also known as CD172a, plays a critical role in regulating immune responses by interacting with the CD47 molecule, which is often referred to as the "don't eat me" signal. This interaction inhibits phagocytosis by macrophages and is crucial for maintaining self-tolerance and preventing autoimmunity. The study of SIRP alpha/CD172a recombinant proteins has gained prominence due to its potential therapeutic implications in cancer immunotherapy and autoimmune diseases. In tumors, cancer cells often overexpress CD47, allowing them to evade immune detection and destruction. By engineering SIRP alpha as a recombinant protein, researchers can block the CD47-SIRP alpha interaction, enhancing phagocytosis of cancer cells by macrophages and promoting anti-tumor immunity. Additionally, SIRP alpha/CD172a protein research provides insights into the mechanisms of immune regulation and has implications for designing novel immunotherapeutic strategies. The development of SIRP alpha/CD172a recombinant protein not only advances our understanding of immune checkpoint pathways but also opens new avenues for clinical applications in treating various malignancies and enhancing the effectiveness of existing immunotherapies. Moreover, the study of this protein contributes to a broader understanding of the immune system's regulation, potentially leading to breakthroughs in managing immune-related disorders.











