Cat: IPD-X18005

Recombinant Human RANK/TNFRSF11A Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RANK/TNFRSF11A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor necrosis factor receptor superfamily member 11A; ODFR; CD265; Tnfrsf11a; Rank

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y6Q6

  • Expression Region

    I30-P212

  • AA Sequence

    IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    25-30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RANK (Receptor Activator of Nuclear Factor κB) and its ligand RANKL play pivotal roles in the regulation of osteoclastogenesis, bone metabolism, and immune responses. RANK is a member of the TNFRSF11A (Tumor Necrosis Factor Receptor Superfamily Member 11A), which is crucial for various biological processes. The interaction between RANK and RANKL is essential for osteoclast differentiation and activation, making it a significant target for understanding bone-related diseases such as osteoporosis and rheumatoid arthritis. Furthermore, RANK signaling is implicated in the development and progression of certain cancers, particularly breast and prostate cancer, where it contributes to metastasis and tumor microenvironment interactions. The production of recombinant RANK/TNFRSF11A proteins allows researchers to explore its molecular mechanisms in vitro and in vivo, facilitating the identification of potential therapeutic targets. Studies involving RANK/TNFRSF11A recombinant proteins not only enhance our understanding of bone biology but also pave the way for novel interventions in bone diseases and cancer treatment, emphasizing the importance of RANK signaling pathways in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US