Cat: IPD-X17906

Recombinant Rat TNFRSF3/LTBR Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF3/LTBR

  • 简介

    TNFRSF3/LTBR Protein, Rat (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Rat (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (M222-W245) with a His tag at the C-terminus[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Rat TNFRSF3 at 5 μg/mL (100 μL/well) can bind biotinylated Human LIGHT. The ED50 for this effect is 35.04 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Rat TNFRSF3 at 1 μg/mL (100 μL/well) can bind biotinylated Human LIGHT .The ED50 for this effect is 86.95 ng/mL.

  • Alternative Names

    Tumor Necrosis Factor Receptor Superfamily Member 3; TNF-RIII; TNFCR; TNFR3

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q5U2S8

  • Expression Region

    S28-A218

  • AA Sequence

    SQPQLVPPYRIENQTCWDPDKEYYEPLHQVCCSRCPPGKFVHAVCSPSQDTVCKTCLHNSYNEHWNHLFSCQLCRPCDSVLGFEEIAPCTSDRKPECRCKPGMSCVYLDNECVHCEEERLVLCRPGTEAEVTDEIMDTEVNCVPCKPGHFQNTSSPRARCQPHTRCESQGLVEAASGTSYSDTICKNPPEA

  • Protein Length

    Partial

  • Molecular Weight

    30-37 kDa due to glycosylation

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of TNFRSF3/LTBR (Tumor Necrosis Factor Receptor Superfamily Member 3/Lymphotoxin Beta Receptor) recombinant protein has gained significant attention in immunology and cancer research due to its crucial role in regulating immune responses and its involvement in lymphoid organ development. LTBR is primarily expressed on lymphoid tissues and various immune cells, influencing lymphocyte proliferation, survival, and differentiation. Additionally, LTBR signaling is essential for maintaining the architecture of secondary lymphoid organs and facilitating the interaction between different immune cell types. Dysregulation of this pathway is implicated in various disease states, including autoimmune disorders and cancer. The production of recombinant LTBR protein enables detailed studies of its structure-function relationships and the exploration of its potential as a therapeutic target. By utilizing recombinant technologies, researchers can investigate how LTBR signaling pathways can be modulated to enhance anti-tumor immunity or suppress inappropriate inflammatory responses. Moreover, understanding the biomechanical interactions between LTBR and its ligands may lead to innovative strategies for augmenting immune responses in clinical applications, such as cancer immunotherapy. Overall, the exploration of TNFRSF3/LTBR recombinant protein represents a promising avenue for advancing our knowledge of immune regulation and developing new therapeutic approaches against diseases characterized by immune dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US