Cat: IPD-X17880

Recombinant Rhesus Macaque TNF RII/TNFRSF1B Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNF RII/TNFRSF1B

  • 简介

    TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Rhesus Macaque (HEK293, His) is expressed by HEK293 and has a transmembrane region (L23-D257) with 6*His tag at the C-terminus[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 1.013 ng/mL in the presence of 2.5 ng/mL of recombinant Human TNF-alpha, corresponding to a specific activity is 9.871×105 U/mg. Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 1.013 ng/mL in the presence of 2.5 ng/mL of recombinant Human TNF-alpha, corresponding to a specific activity is 9.871×105U/mg.

  • Alternative Names

    TNF-R2; CD120b; Tumor necrosis factor receptor superfamily member 1b; p75; Tnfr2

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    F7EAF8

  • Expression Region

    L23-D257

  • AA Sequence

    LPAQVAFTPYAPEPGGTCRLREYYDQTAQMCCSKCPPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAQLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICHVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPAPSTAPGTSFLLPVGPSPPAEGSTGD

  • Protein Length

    Partial

  • Molecular Weight

    35-45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tumor Necrosis Factor Receptor II (TNF RII, also known as TNFRSF1B) is a crucial receptor in the tumor necrosis factor (TNF) signaling pathway, playing a significant role in modulating inflammation and immune responses. Its involvement in various physiological and pathological processes, including immune regulation, cell survival, and apoptosis, has garnered considerable interest in the field of biomedical research. Dysregulation of TNF signaling has been linked to multiple diseases, particularly autoimmune disorders and cancer. Consequently, TNF RII serves as a potential therapeutic target for drug development. Researchers have been focusing on the recombination and expression of TNF RII to better understand its structure-function relationship and to explore its therapeutic potential. By generating recombinant TNF RII proteins, scientists can elucidate the receptor's biochemical characteristics, interaction with ligands, and downstream signaling mechanisms. Furthermore, these recombinant proteins can be utilized in biological assays to discover novel inhibitors or agonists, leading to innovative treatment strategies for related ailments. The growing body of research surrounding TNF RII emphasizes its significance in drug discovery and therapeutic intervention, making it a pivotal focus in the quest for novel approaches to modulate immune responses and combat diseases driven by TNF signaling dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US