Cat: IPD-X17795

Recombinant Mouse TL1A/TNFSF15 Trimer Protein(HEK293) , hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TL1A/TNFSF15 Trimer

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TL1A; VEGI-251; TNFSF15; TL1; VEGI; VEGI192A

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    N-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5UBV8

  • Expression Region

    A61-L252

  • AA Sequence

    AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    50-60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TL1A, also known as TNFSF15, is a member of the tumor necrosis factor (TNF) superfamily that plays a critical role in immune regulation and inflammatory responses. This protein is primarily expressed in the vascular endothelium and local immune cells, and it is known to interact with its receptor, DLK1, to influence T cell activation and proliferation. Research has increasingly focused on TL1A due to its involvement in various autoimmune and inflammatory diseases, such as Crohn’s disease and ulcerative colitis, where it is linked to the pathogenesis and progression of these conditions. The study of TL1A/TNFSF15 trimeric recombinant proteins has gained significance, as understanding their structure and function can provide insights into the mechanisms of immune regulation. Moreover, the potential therapeutic applications of targeting TL1A in disease settings represent a promising avenue for intervention. By producing and characterizing TL1A trimers, researchers aim to dissect its molecular interactions and elucidate its role in modulating the immune response, thereby paving the way for novel treatment strategies that could alleviate the burden of inflammatory diseases. Additionally, the development of TL1A-based biomolecules could facilitate the design of biomarkers or therapeutic agents aimed at tuning immune responses in various pathological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US