Cat: IPD-X17750

Recombinant Mouse APRIL/TNFSF13 Trimer Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APRIL/TNFSF13 Trimer

  • 简介

    APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Mouse APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Mouse is produced by E. coli (R50-L241) with length of 192 amino acids.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rMuApril/TNFSF13; TNFSF 13; TNFSF-13; CD256

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9D777

  • Expression Region

    R50-L241

  • AA Sequence

    MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL

  • Protein Length

    Partial

  • Molecular Weight

    21.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APRIL (A Proliferation-Inducing Ligand) and TNFSF13 (Tumor Necrosis Factor Superfamily Member 13) are key cytokines involved in the regulation of immune responses and B cell survival. APRIL functions as a trimeric protein that binds to its receptors, BAFF-R and TACI, influencing the proliferation, differentiation, and survival of B cells in the immune system. Due to its significant role in promoting B cell maturation and class switching, abnormalities in APRIL signaling are linked to various autoimmune diseases and malignancies. Research into recombinant forms of APRIL/TNFSF13 trimer proteins has gained traction as a potential therapeutic strategy, allowing for the detailed study of their mechanisms and effects on immune modulation. The availability of recombinant APRIL/TNFSF13 trims provides valuable tools for understanding the pathological processes involved in diseases characterized by dysregulated B cell activity. Furthermore, the trimeric structure is crucial for functional activity, as it enhances receptor binding and signaling efficacy. Through the investigation of this recombinant protein, researchers aim to uncover novel insights into the therapeutic targeting of B cell-related disorders and to develop innovative strategies for modulating immune responses in clinical settings. Overall, the study of APRIL/TNFSF13 trimer is at the forefront of immunological research, reflecting its potential applications in treating autoimmune diseases, lymphomas, and other immune-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US