Cat: IPD-X17682

Recombinant Rat OX40 Ligand/TNFSF4 Protein(HEK293) , hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OX40 Ligand/TNFSF4

  • 简介

    OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Rat (HEK293, Fc) is a recombinant rat OX40 Ligand (V20-P210) with C-terminal hFc tag, which is produced in HEK293.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD134L; CD252; Glycoprotein Gp34; OX40 antigen ligand; OX40L; TXGP1

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15725

  • Expression Region

    V20-P210

  • AA Sequence

    VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    65-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OX40 Ligand (OX40L), also known as TNFSF4, is a member of the tumor necrosis factor superfamily and plays a crucial role in regulating immune responses, particularly in T cell activation and survival. OX40L is primarily expressed on antigen-presenting cells and interacts with its receptor OX40 on T cells, leading to enhanced T cell proliferation, survival, and memory formation. The OX40/OX40L pathway has garnered significant interest in cancer immunotherapy, as it can bolster anti-tumor T cell responses. Furthermore, dysregulation of this pathway has been linked to various autoimmune diseases and inflammatory conditions. Research on recombinant OX40L protein involves its production, characterization, and assessment of its effects on T cell function in both in vitro and in vivo models. Understanding the structure-function relationship of OX40L and its interaction with OX40 provides insight into potential therapeutic applications, including the development of OX40 agonists for enhancing T cell responses against tumors or the design of antagonists to mitigate excessive immune activation in autoimmune diseases. Overall, the study of recombinant OX40 Ligand/TNFSF4 is vital for unveiling new strategies in immunotherapy and advancing the field of immune modulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US