Analytical Data
-
Gene name
GM-CSF R alpha
-
简介
GM-CSF R alpha is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2. GM-CSF R alpha binds to the cytokine with high specificity and low affinity[1]. GM-CSF R alpha binds to GM-CSF and induces cell differentiation[2]. GM-CSF R alpha monoclonal antibody decreases GM-CSFRα expression on GM-CSF-responsive cells and shows anti-inflammatory activity in rheumatoid arthritis (RA)[3]. GM-CSF R alpha Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 298 amino acids (E23-G320) and is produced in HEK293 cells.
- Application
-
Biological Activity
1. Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells.The ED50 for this effect is 0.5-2.509 μg/mL. 2. Loaded Mavrilimumab (HY-P99031) on AHC2 biosensor, can bind GM-CSF R alpha Protein, Human (HEK293, His) with an affinity constant of 7.867E-10 M as determined in BLI assay. Measured by its ability to inhibit GM-CSF-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 2.509 μg/mL in the presence of 40 pg/mL of rhGM-CSF. corresponding to a specific activity is 398.5652 units/mg. Loaded Mavrilimumab (HY-P99031) on AHC2 biosensor, can bind GM-CSF R alpha Protein, Human (HEK293, His) with an affinity constant of 7.867E-10 M as determined in BLI assay.
-
Alternative Names
rHuCD116, His; Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; CD116; CSF2RA; CSF2R; CSF2RY
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
P15509
-
Expression Region
E23-G320
-
AA Sequence
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGHHHHHH
-
Protein Length
Extracellular Domain
-
Molecular Weight
54-80 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Related Products
Protein Description
Granulocyte-macrophage colony-stimulating factor receptor alpha (GM-CSF R alpha) plays a crucial role in the immune system, primarily by mediating the effects of granulocyte-macrophage colony-stimulating factor (GM-CSF), which is essential for the proliferation, differentiation, and survival of myeloid progenitor cells. Research on GM-CSF R alpha has gained significant attention due to its involvement in various pathological conditions, including autoimmune diseases, cancer, and inflammatory disorders. The receptor's ability to influence immune responses makes it a promising target for therapeutic interventions. Recombinant GM-CSF R alpha proteins have been developed to understand the receptor's structure-function relationships and to facilitate the screening of potential GM-CSF R alpha antagonists or agonists. These recombinant proteins can be used in various assays to elucidate receptor signaling pathways, identify binding partners, and assess the impact of mutations on receptor function. Understanding the biology of GM-CSF R alpha is not only critical for improving treatments for diseases characterized by dysregulated immune responses but also for developing innovative immunotherapies that harness the body's immune system more effectively. Overall, the study of GM-CSF R alpha and its recombinant forms presents a valuable avenue for advancing our understanding of immune regulation and enhancing therapeutic strategies in immunology.
