Analytical Data
-
Gene name
RANK/TNFRSF11A
- Application
-
Biological Activity
Measured by its ability to inhibit TRANCE-induced osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 28.34 ng/mL in the presence of 10 ng/mL of TRANCE, corresponding to a specific activity is 3.529×104 U/mg. Measured by its ability to inhibit TRANCE-induced osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 28.34 ng/mL in the presence of 10 ng/mL of TRANCE, corresponding to a specific activity is 3.529×104 U/mg.
-
Alternative Names
Tumor necrosis factor receptor superfamily member 11A; ODFR; CD265; Tnfrsf11a; Rank
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O35305
-
Expression Region
V31-S214
-
AA Sequence
VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPS
-
Protein Length
Partial
-
Molecular Weight
26-30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RANK (Receptor Activator of Nuclear Factor κB) and its ligand RANKL play pivotal roles in the regulation of osteoclastogenesis, bone metabolism, and immune responses. RANK is a member of the TNFRSF11A (Tumor Necrosis Factor Receptor Superfamily Member 11A), which is crucial for various biological processes. The interaction between RANK and RANKL is essential for osteoclast differentiation and activation, making it a significant target for understanding bone-related diseases such as osteoporosis and rheumatoid arthritis. Furthermore, RANK signaling is implicated in the development and progression of certain cancers, particularly breast and prostate cancer, where it contributes to metastasis and tumor microenvironment interactions. The production of recombinant RANK/TNFRSF11A proteins allows researchers to explore its molecular mechanisms in vitro and in vivo, facilitating the identification of potential therapeutic targets. Studies involving RANK/TNFRSF11A recombinant proteins not only enhance our understanding of bone biology but also pave the way for novel interventions in bone diseases and cancer treatment, emphasizing the importance of RANK signaling pathways in health and disease.











