Recombinant Human IL4R Protein(HEK293)

IL4R

IL-4R alpha is a subunit alpha shared by IL-4 and IL-13 receptors, found in leukocytes originally. IL-4R alpha couples to the JAK1/2/3-STAT6 pathway and involves in promoting Th2 differentiation[1]. IL-4R alpha/CD124, Human consists of 825 amino acids (M1-S825) with a transmembrane domain (233-256 a.a) and a soluble form (1-227 a.a). Soluble IL-4R (sIL-4R) inhibits IL4-mediated cell proliferation and IL-5 up-regulation by T-cells[1]. IL-4R alpha/CD124, Human (G24-H232) is produced in HEK293 cells with a full length of 209 amino acids.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1. The ED50 is <70 ng/mL, measured in a neutralization assay using TF-1 cells in the presence of 0.5 ng/mL h-IL-4. 2. Measured by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 this effect is 3.143 ng/mL in the presence of 0.2 ng/mL IL4, corresponding to a specific activity is 3.18×105 units/mg. Measured by its ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells.The ED50 for this effect is 3.143 ng/ml in the presence of 0.2ng/ml IL4, corresponding to a specific activity is3.18×105 units/mg.

rHuIL-4R; IL4R; IL-4RA; CD124

Human

HEK293

Tag Free

Greater than 95% as determined by reducing SDS-PAGE.

P24394-1

G24-H232

GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Partial

37-45 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.