Cat: IPD-X16081

Recombinant Human IL-3R alpha/CD123 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-3R alpha/CD123

  • 简介

    FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 is present at 1 μg/mL can bind Recombinant IL-3 R alpha /CD123. The ED50 for this effect is ≤33.72 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-3R alpha Protein. The ED50 for this effect is 20.44 ng/mL.

  • Alternative Names

    Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD123

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P26951-1

  • Expression Region

    T19-R305

  • AA Sequence

    TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    40-72 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-3 receptor alpha (IL-3Rα), also known as CD123, is a crucial component of the IL-3 receptor complex, which plays a significant role in hematopoiesis and immune regulation. Expressed on various hematopoietic cells, including stem cells and progenitor cells, IL-3Rα facilitates the binding of interleukin-3 (IL-3), a key cytokine that promotes cell proliferation, survival, and differentiation. Increased expression of CD123 has been observed in several hematological malignancies, such as acute myeloid leukemia (AML) and other leukemias, making it an attractive target for therapeutic interventions. The development of recombinant IL-3Rα/CD123 proteins holds promise for enabling new strategies in cancer treatment, particularly through targeted therapies such as monoclonal antibodies and chimeric antigen receptor (CAR) T-cell therapies. Research focusing on the structural and functional characterization of IL-3Rα/CD123 recombinant protein seeks to enhance understanding of its role in cellular signaling and to identify potential therapeutic targets. Additionally, the generation of high-purity recombinant proteins can facilitate the development of diagnostic tools and treatment options that could improve patient outcomes in diseases associated with aberrant IL-3 signaling. Investigating the molecular interactions and pathways involving IL-3Rα will contribute further to the field of immunotherapy and potentially lead to novel interventions for hematological cancers and other disorders linked to IL-3 dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US