Analytical Data
-
Gene name
FGFR-3
-
简介
FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine and kidney. FGFR-3 regulates chondrocyte differentiation and proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 is a tumor marker. FGFR-3 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant cynomolgus-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit FGF-acidic dependent proliferation of Balb/c 3T3 mouse fibroblasts, the ED50 for this effect is typically 3.693 ng/mL, corresponding to a specific activity is 2.71×105 units/mg. Measured by its ability to inhibit FGF-acidic dependent proliferation of Balb/c 3T3 mouse fibroblasts, the ED50 for this effect is typically 3.693 ng/mL, corresponding to a specific activity is 2.71×105 units/mg.
-
Alternative Names
Fibroblast growth factor receptor 3; FGFR-3; CD333; Mfr3; Sam3
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
F7FZR9
-
Expression Region
E23-G375
-
AA Sequence
ESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
-
Protein Length
Partial
-
Molecular Weight
55-77 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor receptor 3 (FGFR-3) is a transmembrane protein that plays a critical role in regulating cell growth, differentiation, and apoptosis, particularly in bone and cartilage development. Mutations in the FGFR3 gene are associated with various skeletal disorders, most notably achondroplasia, the most common form of disproportionate dwarfism. Research into FGFR-3 recombinant proteins is pivotal for understanding its biological functions and the mechanisms underlying FGFR-3-related diseases. By producing recombinant FGFR-3 proteins, scientists can investigate the signaling pathways affected by its mutations and explore potential therapeutic targets for conditions resulting from FGFR-3 dysregulation. These studies also facilitate the development of drugs that could modulate FGFR-3 activity, offering hope for novel treatments for skeletal dysplasias and other FGFR-3 related anomalies. Furthermore, the recombinant protein serves as a valuable tool for structure-function analyses, enabling the identification of crucial domains for ligand interaction and receptor activation. Overall, FGFR-3 recombinant protein research is at the forefront of both congenital disorder investigations and the broader field of targeted molecular therapies.
